From eaf38c0c567f79c4008cbad8c69575195b216e00 Mon Sep 17 00:00:00 2001 From: Jasper Bok Date: Fri, 16 Dec 2022 17:40:06 +0100 Subject: [PATCH] Add solution for day 6 --- day6/input.txt | 1 + day6/part1.py | 86 ++++++++++++++++++++++++++++++++++++++++++++++ day6/part2.py | 49 ++++++++++++++++++++++++++ day6/testinput.txt | 1 + 4 files changed, 137 insertions(+) create mode 100644 day6/input.txt create mode 100644 day6/part1.py create mode 100644 day6/part2.py create mode 100644 day6/testinput.txt diff --git a/day6/input.txt b/day6/input.txt new file mode 100644 index 0000000..68bd997 --- /dev/null +++ b/day6/input.txt @@ -0,0 +1 @@ +pjbjvjtjljplppjssvtvwtwptptztltbtrrjgrjrzrqrjrbrhbrhrlllbpbdbbzqqgsqshqssjjbsjbsbmbhhmchhrqrcqqbwbqwwqrrznnsbswwwdjwdwmmsvszzlbbgddbgdgfgttzjzrjzrjzzvrvqqgpqggtbgtgvvrhvhtvtjjbpjjfjhjbhbddbjjjmzmtmgmpgmmmljlnljjmpmbpmbmrrlhhlppdgdfgfbbqlbbtffjjgvvnpvpbpttqmmnhhgfgrrwhrrbnbznzccmbmvmmzszsvsbvbccsrslsjsbbtdtwtvttvpvzzvbzzwczwcczhzhwhjhjghgppgpgttdwdhwhphnppqmpqqhthcchdhmhnnbcnbcbbggbfblljttwsswspsggpjjzszcscsmcmdmnngzzhrzrbrhbhzbzvzgvgffnlnljlrrhchhsvhssmpmccncdnccgdgbglgtlggnllsvvpfvpfpbffsgglddjrrzzphhptprtppwrwffzllrbrmrpmpdmpdmpplpspcphcphhgmmqnmmvnmmdvmvsmmqjmmlmlbmlbmlltlptphpnncscbscbcggwhhgjgqjqmjmdjmdjdrrvgvvzlldgdnnvttmmpffdjjvvchcwwbhwbwzzlmlccrttcntccpcgccpgcpggdrrbtrthhlrrbqrrpspdsdldbldblbzbpbgggtngtgqqtwwdjjmmcrmcrcvclcddhllpzpdzzmccrtccfvffccfhccpscctbbbzqzvvllgwlgwgvwwjswjswsvvwhhvjvsjvjmmjhjrhrmrvrnrccmnmzzmdzzbtbvbqvvgzgcgvvvvlltvllbfbqqrppwhpwpffzddzdzwdzzrggmhmfhmhbbzjzsjzzhhjdhhdnndsnssnfffbmffwhwrhhmmbnnbrnrbrrtqtztnzzzzblbhbdhbbfmfqfmmsgszzvfzfmfwfnwfwggwngnqnwqnwqwvwqvwvdvrvjjfnjnmnfmmwzzltztjjqnnnmlmzlmmrcmclcqqhrhdhccdfdvfvccvtcvvdmmtmccwjjcbcrrjmrjrdrffgwwvbvlvsspwpsspzsschssmqsqmqmlqmmqgqfqcqjcjtthjttlddfvvwwjvvtpvvfsvffqnffznzqzszgzmmjttwztwzzhqqccqsqmqnmqqjhqhzhwhvhdddsndsdfftvffwlwnnmmdpmmnhhrqrrclcdlcddhcdcppgrprnpnptnpphgpbqfngdgzvgndwcgrwcsfmhzsvddhzbgjmvvdjjzswvgnpmvgdpwsgbgjzjpsrfdzdzjzzrpplbhsmgddqzjbdzdzltqqwqjzqvwfmcdppbdbprrwzhmnrqclzrnmdjnfbwmvdrwtpwvgscrqgpndqnzbjsbljcbthbpgdjdcdwfhpvjnbsfjdlrjldvvmtfdslrhlfwmvclqrljrqmmjgqfwmfgwdjzzptgcthvtgdswsqjrqvnzmtqldjjcqnfhtvbwhjqlvpptfwjrdpcwvzddgcjzvqbhtsnnnjqqmqlbgvqmvjhvvpbzcbdmhgmcjbfcccsvlzjztvjzrrlhtgwccdcgcptqlmdhmdhvqzfntbjqtsmvqgwsltqntgszllntrljfgfsghtbbcqrdgwqphmbqtzmjqccrgvqpqpchzjstdmmtvntwjqsbcqjgnhzlllcfbpgtgrhwwhqqdlgrlsbzbmchvjnsgpdnmqvtgwqjpgflqgfngjfcfwqzmvvgzmmhbgfnbzvzclwclqdcccgbrrzpwdtprgsvhbgsnbntgrvnzhrnzfzdmnlbnrbqvmjbwpgvjlhbcvsrlqmcsnlrvtfdwtvcbmlndgbctsnmtctjszlpddqmzbtphhhfznwbdfsgppmdmczmhmmrzpllfqqbgvlsrscpfgznhdhgrnnnvrchgvzlqbgvcfghjvlvrvpclfcshbmvglcfrjbzrbcjmjjrfgqthwfrqbgtjldmbnfwllspmwrvstvrltvrlvrtjvprgtgzjlrgclvjhqpfcwcdbdtzwdsdfrtsvtvgjmsszdfqlmhqqlzswjfndswlmhcrhglphvpnfjpbmggbwlmzjchpnrllbjpmgmzjjrqpqgsbrszqhdljcpnclvrvbntgtcdcmhtdhgslhpvdjpvrszfrjhsbvcvtfwvvgczprnpbhmnnlmctbtqdjspgvhvnhwvspwgnjvzllwlnjhfjwsslppmjbfbdnthcpzbcmnnbvhctgwgdvhvlrbltmdnlfcsncqgrmjprshdvvtvcccgzhszcjgczhmhtvmccjpchqshhdzjjhbfpzqdjszdhdvlmgctmwcjprwlsqbcqhlcrfdgnqzfdfvqslmqlppbsvbmjmfbrtdmpmtqvwvppcfzddjzhhzlrrnnhbrlhmzlqwftprfvctnfhfhfzrnrvggfqmqwcwszhtbfjncprgwcqbjlvtnrprlwwghswvprjmsbmqvwnnfggprndvshfvvwtrqjpwghgbppftgzhqjslfzhngwfsjnmjzdsjqgpmglwnjlcgmczgvndszrszcpnzqpbzjmgrfsbjlghwrbqsqdhlnhzsvsgbqhbcdffjlgrbdrrjvclzqpftlhdvvcrvlgvlpnjcqdcbdjtlwnldjhhhzrwsqlhlsztwrznfsszptlrhjmqwmnfwjtjwmmmtvwzhpmjgzgsscbddgvvhpcnhvnggzhbzvvjlmdftpbcsvtsttrvgghptmmcdclbdvmnsdntthfbdznbclwccnlzcvdwzrqgddjszvbdqcjppzrtpnrhfcvvwpjqczgqwzzzvzmlnlzqszvtllftthgwgftjzsndpzzcnqpcvmsdvvfrjdsvfclsqqhsjrrctfvdrlhfmhprjggdcmqrrbqtwnrllhhztvjgmzqszbvqfwsgllvhsvfrjffvdscwjzqlzlwdpgthddpgzjfdbdqpsnntwpslvsdpqfnsgcllszcjwvtqhwhpfrlfdgwrfmgfpjmvnstrmtfcvgwlqdfqvntltqtrmjjtwcthvwntqgvncssplnmvlnstlcphvlcmvjnstwldtntchcbmzmlzhgjfbrdlgzvqpgcndmfdnmcnwhmpdnpqstfddddcrpgrpfwfbzjqtnzwwqpzrqpmrjpfznrndfgwhtlvrcrphqfjzjbttwhgnsngqwvnsbvcqtjlmhvmnmnnmjcmlpnpgmrqsbmgljvsfqvrlljqzmzqqbgpvcrwdjmgsglssjswmnvtshhfqjhqmfmvcjwfpwsppgtrqsbhhcdljnjphnjszqpvdplbwzpwmmpwfhmhngtllzqvpmgdctmfqwwqjszssmjhwnrjdtmmvpdnwlqtcbpfcmwtbjmmsmmdpqgzdhsblgjmjbpzgqvqhnggtwmhztbbhlflllgwblncjjsngdgvsfdmsbsvlpnjjzqqbzhsqclmjnnmmwlpvtgwqmcgmrqdwdddlgbvhntbztbjnqhdlggnzwsdtdzprgddhtcttjrcpszgchtfwqjsdlnbntfwqpzpfsqrqjhthmcfszwtwcqwbvfzdnrrpmzjdrhsgmhfbsldvcrjdwvpqpszzlvbptljgvccqsdhhnztjpghbvhfptgplqdvldjzfthpspwvgljwnnndwrqzbrstnqbvrrcghssnrpvtrhmvcmbngwndzfswmgjwnnzqdcjhpthcgvthsnwqzrnzrvdjmctchhsbnrtvctzqfpcjhzmhnfjlqftbjztfbcppgmwvrzzrvlcpnpwwpvtcpdplrcfpgfqjtlfjtphhpcltwqcbqbznbtjrtdrpgtvzmgsclhpptrssqqbctdrftqzmwjmrmjtgmjmsnbnspjvcqpqnmgzgjrmfhghvsfsdqnbdjsbcpczsdswdcvhfzlgpzbtmztcnbpcvjnlcdmmlbtwzsfqtfnlrwjtwmgslcgptgbdsfwdhppvfwbbgdfdqtrbncbznmqtchzsdzlhlhjnnbpdvnnfjrdfbdqmvcb diff --git a/day6/part1.py b/day6/part1.py new file mode 100644 index 0000000..c104285 --- /dev/null +++ b/day6/part1.py @@ -0,0 +1,86 @@ +""" +--- Day 6: Tuning Trouble --- + +The preparations are finally complete; you and the Elves leave camp on +foot and begin to make your way toward the star fruit grove. + +As you move through the dense undergrowth, one of the Elves gives you a +handheld device. He says that it has many fancy features, but the most +important one to set up right now is the communication system. + +However, because he's heard you have significant experience dealing with +signal-based systems, he convinced the other Elves that it would be okay +to give you their one malfunctioning device - surely you'll have no +problem fixing it. + +As if inspired by comedic timing, the device emits a few colorful sparks. + +To be able to communicate with the Elves, the device needs to lock on +to their signal. The signal is a series of seemingly-random characters +that the device receives one at a time. + +To fix the communication system, you need to add a subroutine to the +device that detects a start-of-packet marker in the datastream. In the +protocol being used by the Elves, the start of a packet is indicated by +a sequence of four characters that are all different. + +The device will send your subroutine a datastream buffer (your puzzle +input); your subroutine needs to identify the first position where the +four most recently received characters were all different. Specifically, +it needs to report the number of characters from the beginning of the +buffer to the end of the first such four-character marker. + +For example, suppose you receive the following datastream buffer: + + mjqjpqmgbljsphdztnvjfqwrcgsmlb + +After the first three characters (mjq) have been received, there haven't +been enough characters received yet to find the marker. The first time a +marker could occur is after the fourth character is received, making the +most recent four characters mjqj. Because j is repeated, this isn't a +marker. + +The first time a marker appears is after the seventh character arrives. +Once it does, the last four characters received are jpqm, which are all +different. In this case, your subroutine should report the value 7, +because the first start-of-packet marker is complete after 7 characters +have been processed. + +Here are a few more examples: + + bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 5 + nppdvjthqldpwncqszvftbrmjlhg: first marker after character 6 + nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 10 + zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 11 + +How many characters need to be processed before the first +start-of-packet marker is detected? +""" + + +def main(): + with open("input.txt", "r", encoding="utf-8") as input_file: + data_stream = input_file.read() + + read_chars = [] + + for index, char in enumerate(data_stream): + read_chars.append(char) + + # We need 4 unique characters, so as long as less than 4 chars + # were read, just continue loading characters. + if len(read_chars) < 4: + continue + + # We only need the last 4 characters to compare, so if we load + # a fifth char we can pop the oldest out of the list. + if len(read_chars) == 5: + read_chars.pop(0) + + if len(set(read_chars)) == 4: + print(f"After {index+1} chars") + break + + +if __name__ == "__main__": + main() diff --git a/day6/part2.py b/day6/part2.py new file mode 100644 index 0000000..8ed50cc --- /dev/null +++ b/day6/part2.py @@ -0,0 +1,49 @@ +""" +--- Part Two --- + +Your device's communication system is correctly detecting packets, but +still isn't working. It looks like it also needs to look for messages. + +A start-of-message marker is just like a start-of-packet marker, except +it consists of 14 distinct characters rather than 4. + +Here are the first positions of start-of-message markers for all of the +above examples: + + mjqjpqmgbljsphdztnvjfqwrcgsmlb: first marker after character 19 + bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 23 + nppdvjthqldpwncqszvftbrmjlhg: first marker after character 23 + nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 29 + zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 26 + +How many characters need to be processed before the first +start-of-message marker is detected? +""" + + +def main(): + with open("input.txt", "r", encoding="utf-8") as input_file: + data_stream = input_file.read() + + read_chars = [] + + for index, char in enumerate(data_stream): + read_chars.append(char) + + # We need 14 unique characters, so as long as less than 14 chars + # were read, just continue loading characters. + if len(read_chars) < 14: + continue + + # We only need the last 4 characters to compare, so if we load + # a fifth char we can pop the oldest out of the list. + if len(read_chars) == 15: + read_chars.pop(0) + + if len(set(read_chars)) == 14: + print(f"After {index+1} chars") + break + + +if __name__ == "__main__": + main() diff --git a/day6/testinput.txt b/day6/testinput.txt new file mode 100644 index 0000000..7980a82 --- /dev/null +++ b/day6/testinput.txt @@ -0,0 +1 @@ +mjqjpqmgbljsphdztnvjfqwrcgsmlb