Add solution for day 6
parent
d1498c581e
commit
eaf38c0c56
|
@ -0,0 +1 @@
|
||||||
|
pjbjvjtjljplppjssvtvwtwptptztltbtrrjgrjrzrqrjrbrhbrhrlllbpbdbbzqqgsqshqssjjbsjbsbmbhhmchhrqrcqqbwbqwwqrrznnsbswwwdjwdwmmsvszzlbbgddbgdgfgttzjzrjzrjzzvrvqqgpqggtbgtgvvrhvhtvtjjbpjjfjhjbhbddbjjjmzmtmgmpgmmmljlnljjmpmbpmbmrrlhhlppdgdfgfbbqlbbtffjjgvvnpvpbpttqmmnhhgfgrrwhrrbnbznzccmbmvmmzszsvsbvbccsrslsjsbbtdtwtvttvpvzzvbzzwczwcczhzhwhjhjghgppgpgttdwdhwhphnppqmpqqhthcchdhmhnnbcnbcbbggbfblljttwsswspsggpjjzszcscsmcmdmnngzzhrzrbrhbhzbzvzgvgffnlnljlrrhchhsvhssmpmccncdnccgdgbglgtlggnllsvvpfvpfpbffsgglddjrrzzphhptprtppwrwffzllrbrmrpmpdmpdmpplpspcphcphhgmmqnmmvnmmdvmvsmmqjmmlmlbmlbmlltlptphpnncscbscbcggwhhgjgqjqmjmdjmdjdrrvgvvzlldgdnnvttmmpffdjjvvchcwwbhwbwzzlmlccrttcntccpcgccpgcpggdrrbtrthhlrrbqrrpspdsdldbldblbzbpbgggtngtgqqtwwdjjmmcrmcrcvclcddhllpzpdzzmccrtccfvffccfhccpscctbbbzqzvvllgwlgwgvwwjswjswsvvwhhvjvsjvjmmjhjrhrmrvrnrccmnmzzmdzzbtbvbqvvgzgcgvvvvlltvllbfbqqrppwhpwpffzddzdzwdzzrggmhmfhmhbbzjzsjzzhhjdhhdnndsnssnfffbmffwhwrhhmmbnnbrnrbrrtqtztnzzzzblbhbdhbbfmfqfmmsgszzvfzfmfwfnwfwggwngnqnwqnwqwvwqvwvdvrvjjfnjnmnfmmwzzltztjjqnnnmlmzlmmrcmclcqqhrhdhccdfdvfvccvtcvvdmmtmccwjjcbcrrjmrjrdrffgwwvbvlvsspwpsspzsschssmqsqmqmlqmmqgqfqcqjcjtthjttlddfvvwwjvvtpvvfsvffqnffznzqzszgzmmjttwztwzzhqqccqsqmqnmqqjhqhzhwhvhdddsndsdfftvffwlwnnmmdpmmnhhrqrrclcdlcddhcdcppgrprnpnptnpphgpbqfngdgzvgndwcgrwcsfmhzsvddhzbgjmvvdjjzswvgnpmvgdpwsgbgjzjpsrfdzdzjzzrpplbhsmgddqzjbdzdzltqqwqjzqvwfmcdppbdbprrwzhmnrqclzrnmdjnfbwmvdrwtpwvgscrqgpndqnzbjsbljcbthbpgdjdcdwfhpvjnbsfjdlrjldvvmtfdslrhlfwmvclqrljrqmmjgqfwmfgwdjzzptgcthvtgdswsqjrqvnzmtqldjjcqnfhtvbwhjqlvpptfwjrdpcwvzddgcjzvqbhtsnnnjqqmqlbgvqmvjhvvpbzcbdmhgmcjbfcccsvlzjztvjzrrlhtgwccdcgcptqlmdhmdhvqzfntbjqtsmvqgwsltqntgszllntrljfgfsghtbbcqrdgwqphmbqtzmjqccrgvqpqpchzjstdmmtvntwjqsbcqjgnhzlllcfbpgtgrhwwhqqdlgrlsbzbmchvjnsgpdnmqvtgwqjpgflqgfngjfcfwqzmvvgzmmhbgfnbzvzclwclqdcccgbrrzpwdtprgsvhbgsnbntgrvnzhrnzfzdmnlbnrbqvmjbwpgvjlhbcvsrlqmcsnlrvtfdwtvcbmlndgbctsnmtctjszlpddqmzbtphhhfznwbdfsgppmdmczmhmmrzpllfqqbgvlsrscpfgznhdhgrnnnvrchgvzlqbgvcfghjvlvrvpclfcshbmvglcfrjbzrbcjmjjrfgqthwfrqbgtjldmbnfwllspmwrvstvrltvrlvrtjvprgtgzjlrgclvjhqpfcwcdbdtzwdsdfrtsvtvgjmsszdfqlmhqqlzswjfndswlmhcrhglphvpnfjpbmggbwlmzjchpnrllbjpmgmzjjrqpqgsbrszqhdljcpnclvrvbntgtcdcmhtdhgslhpvdjpvrszfrjhsbvcvtfwvvgczprnpbhmnnlmctbtqdjspgvhvnhwvspwgnjvzllwlnjhfjwsslppmjbfbdnthcpzbcmnnbvhctgwgdvhvlrbltmdnlfcsncqgrmjprshdvvtvcccgzhszcjgczhmhtvmccjpchqshhdzjjhbfpzqdjszdhdvlmgctmwcjprwlsqbcqhlcrfdgnqzfdfvqslmqlppbsvbmjmfbrtdmpmtqvwvppcfzddjzhhzlrrnnhbrlhmzlqwftprfvctnfhfhfzrnrvggfqmqwcwszhtbfjncprgwcqbjlvtnrprlwwghswvprjmsbmqvwnnfggprndvshfvvwtrqjpwghgbppftgzhqjslfzhngwfsjnmjzdsjqgpmglwnjlcgmczgvndszrszcpnzqpbzjmgrfsbjlghwrbqsqdhlnhzsvsgbqhbcdffjlgrbdrrjvclzqpftlhdvvcrvlgvlpnjcqdcbdjtlwnldjhhhzrwsqlhlsztwrznfsszptlrhjmqwmnfwjtjwmmmtvwzhpmjgzgsscbddgvvhpcnhvnggzhbzvvjlmdftpbcsvtsttrvgghptmmcdclbdvmnsdntthfbdznbclwccnlzcvdwzrqgddjszvbdqcjppzrtpnrhfcvvwpjqczgqwzzzvzmlnlzqszvtllftthgwgftjzsndpzzcnqpcvmsdvvfrjdsvfclsqqhsjrrctfvdrlhfmhprjggdcmqrrbqtwnrllhhztvjgmzqszbvqfwsgllvhsvfrjffvdscwjzqlzlwdpgthddpgzjfdbdqpsnntwpslvsdpqfnsgcllszcjwvtqhwhpfrlfdgwrfmgfpjmvnstrmtfcvgwlqdfqvntltqtrmjjtwcthvwntqgvncssplnmvlnstlcphvlcmvjnstwldtntchcbmzmlzhgjfbrdlgzvqpgcndmfdnmcnwhmpdnpqstfddddcrpgrpfwfbzjqtnzwwqpzrqpmrjpfznrndfgwhtlvrcrphqfjzjbttwhgnsngqwvnsbvcqtjlmhvmnmnnmjcmlpnpgmrqsbmgljvsfqvrlljqzmzqqbgpvcrwdjmgsglssjswmnvtshhfqjhqmfmvcjwfpwsppgtrqsbhhcdljnjphnjszqpvdplbwzpwmmpwfhmhngtllzqvpmgdctmfqwwqjszssmjhwnrjdtmmvpdnwlqtcbpfcmwtbjmmsmmdpqgzdhsblgjmjbpzgqvqhnggtwmhztbbhlflllgwblncjjsngdgvsfdmsbsvlpnjjzqqbzhsqclmjnnmmwlpvtgwqmcgmrqdwdddlgbvhntbztbjnqhdlggnzwsdtdzprgddhtcttjrcpszgchtfwqjsdlnbntfwqpzpfsqrqjhthmcfszwtwcqwbvfzdnrrpmzjdrhsgmhfbsldvcrjdwvpqpszzlvbptljgvccqsdhhnztjpghbvhfptgplqdvldjzfthpspwvgljwnnndwrqzbrstnqbvrrcghssnrpvtrhmvcmbngwndzfswmgjwnnzqdcjhpthcgvthsnwqzrnzrvdjmctchhsbnrtvctzqfpcjhzmhnfjlqftbjztfbcppgmwvrzzrvlcpnpwwpvtcpdplrcfpgfqjtlfjtphhpcltwqcbqbznbtjrtdrpgtvzmgsclhpptrssqqbctdrftqzmwjmrmjtgmjmsnbnspjvcqpqnmgzgjrmfhghvsfsdqnbdjsbcpczsdswdcvhfzlgpzbtmztcnbpcvjnlcdmmlbtwzsfqtfnlrwjtwmgslcgptgbdsfwdhppvfwbbgdfdqtrbncbznmqtchzsdzlhlhjnnbpdvnnfjrdfbdqmvcb
|
|
@ -0,0 +1,86 @@
|
||||||
|
"""
|
||||||
|
--- Day 6: Tuning Trouble ---
|
||||||
|
|
||||||
|
The preparations are finally complete; you and the Elves leave camp on
|
||||||
|
foot and begin to make your way toward the star fruit grove.
|
||||||
|
|
||||||
|
As you move through the dense undergrowth, one of the Elves gives you a
|
||||||
|
handheld device. He says that it has many fancy features, but the most
|
||||||
|
important one to set up right now is the communication system.
|
||||||
|
|
||||||
|
However, because he's heard you have significant experience dealing with
|
||||||
|
signal-based systems, he convinced the other Elves that it would be okay
|
||||||
|
to give you their one malfunctioning device - surely you'll have no
|
||||||
|
problem fixing it.
|
||||||
|
|
||||||
|
As if inspired by comedic timing, the device emits a few colorful sparks.
|
||||||
|
|
||||||
|
To be able to communicate with the Elves, the device needs to lock on
|
||||||
|
to their signal. The signal is a series of seemingly-random characters
|
||||||
|
that the device receives one at a time.
|
||||||
|
|
||||||
|
To fix the communication system, you need to add a subroutine to the
|
||||||
|
device that detects a start-of-packet marker in the datastream. In the
|
||||||
|
protocol being used by the Elves, the start of a packet is indicated by
|
||||||
|
a sequence of four characters that are all different.
|
||||||
|
|
||||||
|
The device will send your subroutine a datastream buffer (your puzzle
|
||||||
|
input); your subroutine needs to identify the first position where the
|
||||||
|
four most recently received characters were all different. Specifically,
|
||||||
|
it needs to report the number of characters from the beginning of the
|
||||||
|
buffer to the end of the first such four-character marker.
|
||||||
|
|
||||||
|
For example, suppose you receive the following datastream buffer:
|
||||||
|
|
||||||
|
mjqjpqmgbljsphdztnvjfqwrcgsmlb
|
||||||
|
|
||||||
|
After the first three characters (mjq) have been received, there haven't
|
||||||
|
been enough characters received yet to find the marker. The first time a
|
||||||
|
marker could occur is after the fourth character is received, making the
|
||||||
|
most recent four characters mjqj. Because j is repeated, this isn't a
|
||||||
|
marker.
|
||||||
|
|
||||||
|
The first time a marker appears is after the seventh character arrives.
|
||||||
|
Once it does, the last four characters received are jpqm, which are all
|
||||||
|
different. In this case, your subroutine should report the value 7,
|
||||||
|
because the first start-of-packet marker is complete after 7 characters
|
||||||
|
have been processed.
|
||||||
|
|
||||||
|
Here are a few more examples:
|
||||||
|
|
||||||
|
bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 5
|
||||||
|
nppdvjthqldpwncqszvftbrmjlhg: first marker after character 6
|
||||||
|
nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 10
|
||||||
|
zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 11
|
||||||
|
|
||||||
|
How many characters need to be processed before the first
|
||||||
|
start-of-packet marker is detected?
|
||||||
|
"""
|
||||||
|
|
||||||
|
|
||||||
|
def main():
|
||||||
|
with open("input.txt", "r", encoding="utf-8") as input_file:
|
||||||
|
data_stream = input_file.read()
|
||||||
|
|
||||||
|
read_chars = []
|
||||||
|
|
||||||
|
for index, char in enumerate(data_stream):
|
||||||
|
read_chars.append(char)
|
||||||
|
|
||||||
|
# We need 4 unique characters, so as long as less than 4 chars
|
||||||
|
# were read, just continue loading characters.
|
||||||
|
if len(read_chars) < 4:
|
||||||
|
continue
|
||||||
|
|
||||||
|
# We only need the last 4 characters to compare, so if we load
|
||||||
|
# a fifth char we can pop the oldest out of the list.
|
||||||
|
if len(read_chars) == 5:
|
||||||
|
read_chars.pop(0)
|
||||||
|
|
||||||
|
if len(set(read_chars)) == 4:
|
||||||
|
print(f"After {index+1} chars")
|
||||||
|
break
|
||||||
|
|
||||||
|
|
||||||
|
if __name__ == "__main__":
|
||||||
|
main()
|
|
@ -0,0 +1,49 @@
|
||||||
|
"""
|
||||||
|
--- Part Two ---
|
||||||
|
|
||||||
|
Your device's communication system is correctly detecting packets, but
|
||||||
|
still isn't working. It looks like it also needs to look for messages.
|
||||||
|
|
||||||
|
A start-of-message marker is just like a start-of-packet marker, except
|
||||||
|
it consists of 14 distinct characters rather than 4.
|
||||||
|
|
||||||
|
Here are the first positions of start-of-message markers for all of the
|
||||||
|
above examples:
|
||||||
|
|
||||||
|
mjqjpqmgbljsphdztnvjfqwrcgsmlb: first marker after character 19
|
||||||
|
bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 23
|
||||||
|
nppdvjthqldpwncqszvftbrmjlhg: first marker after character 23
|
||||||
|
nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 29
|
||||||
|
zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 26
|
||||||
|
|
||||||
|
How many characters need to be processed before the first
|
||||||
|
start-of-message marker is detected?
|
||||||
|
"""
|
||||||
|
|
||||||
|
|
||||||
|
def main():
|
||||||
|
with open("input.txt", "r", encoding="utf-8") as input_file:
|
||||||
|
data_stream = input_file.read()
|
||||||
|
|
||||||
|
read_chars = []
|
||||||
|
|
||||||
|
for index, char in enumerate(data_stream):
|
||||||
|
read_chars.append(char)
|
||||||
|
|
||||||
|
# We need 14 unique characters, so as long as less than 14 chars
|
||||||
|
# were read, just continue loading characters.
|
||||||
|
if len(read_chars) < 14:
|
||||||
|
continue
|
||||||
|
|
||||||
|
# We only need the last 4 characters to compare, so if we load
|
||||||
|
# a fifth char we can pop the oldest out of the list.
|
||||||
|
if len(read_chars) == 15:
|
||||||
|
read_chars.pop(0)
|
||||||
|
|
||||||
|
if len(set(read_chars)) == 14:
|
||||||
|
print(f"After {index+1} chars")
|
||||||
|
break
|
||||||
|
|
||||||
|
|
||||||
|
if __name__ == "__main__":
|
||||||
|
main()
|
|
@ -0,0 +1 @@
|
||||||
|
mjqjpqmgbljsphdztnvjfqwrcgsmlb
|
Loading…
Reference in New Issue